Shanghai Sonyt Biotechnology Co., Ltd. is one of the leading manufacturers and suppliers of 5-tamra-amyloid β-protein (1-40) in China, also supports custom service. Welcome to wholesale bulk high quality 5-tamra-amyloid β-protein (1-40) from our factory. Contact us for more details.
| Description | 5-TAMRA-Aβ(1-40) is the 5-carboxytetramethylrhodamine conjugate of Aβ1-40 (Ex/Em ~557/570 nm, orange-red). Paired with 5-FAM/FITC-Aβ it forms a FRET dual-color system to report interpeptide proximity, oligomerization and fibrillation; the long wavelength also reduces tissue-autofluorescence background for amyloid imaging and inhibitor screening. |
| CAS No. | 1802087-81-5 |
| Molecular weight (Da) | ~4746 (5-TAMRA conjugate) |
| Structure type | Linear 40-mer (Aβ1-40, 5-TAMRA-labeled) |
| Solubility | NaOH pre-dispersion then pH adjust; protect from light |
| Storage | Powder, −20°C, dry, light-protected |
Product Basic Information Table
| Product Standard English Name | Product Abbreviation / Alias | Function Tags (comma-separated) | Core Structure | Molecular Formula | Exact Mass (Da) | Average MW (Da) | Salt Form | Length (aa) |
| 5-TAMRA-Amyloid β-Protein (1-40), N-terminally TAMRA-Labeled Peptide | TAMRA-Aβ(1-40); 5-TAMRA-Amyloid β(1-40); TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV; tetramethylrhodamine-labeled beta-amyloid 1-40; fluorescent Aβ; λex=544 nm/λem=570 nm; FRET pair with FAM-Aβ; CAS 1802087-81-5 | fluorescent-labeled peptide, TAMRA label, β-amyloid peptide, Aβ(1-40), Alzheimer's disease, Aβ aggregation/fibrils, FRET aggregation assay, rhodamine orange-red fluorescence, light-sensitive, Met oxidation-prone, HFIP pre-treatment | Linear 40-mer, sequence TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV (human Aβ1-40); 5-carboxytetramethylrhodamine (5-TAMRA) conjugated via an amide bond to the N-terminal alpha-amine of Asp; C-terminal free Val-OH; TAMRA net addition C25H20N2O4 (reverse-derived and corrected against CAS 1802087-81-5 supplier formula C219H315N55O62S); N-terminal alpha-amine acylated and uncharged; net charge ~-4 at pH 7 (Arg +1, Lys16/Lys28 side chains +3; Asp/Glu side chains -6; C-terminus -1; three His partially protonated); the C-terminal hydrophobic region KGA IIGLMVGGVV (residues 30-40) is highly hydrophobic and drives Aβ(1-40) aggregation/fibrillization; contains 1 Met35 (oxidation-prone), 1 Tyr, and the Phe19-Phe20 hydrophobic aromatic cluster; TAMRA is an orange-red rhodamine fluorophore, λex≈544 nm/λem≈570 nm, commonly paired with FAM-Aβ(1-40) for aggregation FRET. | C219H315N55O62S | 4739.29 | 4742.31 | Free acid (C-terminal -COOH); TFA/acetate forms available on request; N-terminal 5-TAMRA label; CAS 1802087-81-5 | 40 |
Physicochemical Solubility & Storage Parameters
| Product Code | Appearance | Long-term Storage | Short-term Storage | Solution Stability | Solid Powder Stability |
| PEP-TAMRAAB40-01 | Pink to red powder (TAMRA rhodamine pigment) | Store at -20C, sealed, desiccated, LIGHT-PROTECTED (amber tube/aluminum foil), ~2 years; strongly recommend aliquoting to avoid repeated freeze-thaw. The powder must be light- and moisture-protected. Aβ(1-40) is highly hydrophobic and aggregation-prone-HFIP pre-treat and aliquot immediately upon receipt; contains oxidation-prone Met-flush with argon/nitrogen. | 2-8C, light-protected, for ~2 weeks; working aliquots at -80C, light-protected (after HFIP pre-treatment); avoid room-temperature exposure. Ship on dry ice, protected from light. | Aβ(1-40) is strongly hydrophobic (C-terminal IIGLMVGGVV region); poor water solubility and spontaneous self-assembly into oligomers/fibrils. MUST follow the standard protocol: (1) reconstitute powder in hexafluoroisopropanol (HFIP) to 1 mM; sonicate/vortex to disaggregate pre-existing oligomers; (2) incubate at RT for 2-4 h to fully dissociate aggregates; (3) aliquot and blow dry HFIP with nitrogen/argon; (4) store dried films at -80C; before use, freshly reconstitute in DMSO or neutral buffer (pH 7.4 PBS/HEPES); (5) prepare fresh and avoid repeated freeze-thaw. PROTECT TAMRA FLUORESCENCE FROM LIGHT throughout (aluminum foil). Commonly mixed with FAM-Aβ(1-40) at defined ratios for FRET co-aggregation; Met35 is oxidation-prone and oxidized Aβ has altered aggregation behavior-control oxygen. | solid stable ~2 years at -20C, sealed, desiccated, light-protected; contains TAMRA (light-sensitive) and Met (oxidizable)-store light-protected, dry, under inert gas. HFIP pre-treatment and aliquoting upon receipt is recommended to destroy pre-aggregates. |
Functional Description
| Product Code | Frontend Short Summary | Detailed Biological Function Description | Applicable Research Areas (comma-separated) | Targets / Pathways |
| PEP-TAMRAAB40-01 | N-terminally 5-TAMRA orange-red fluorescent-labeled Aβ(1-40) (λex/em≈544/570 nm) for Alzheimer's disease Aβ aggregation FRET/ThT co-aggregation, dual-label aggregation kinetics paired with FAM-Aβ, and fluorescent tracing; highly hydrophobic and aggregation-prone-requires HFIP pre-treatment, light-protected aliquoting, and -80C storage. | Amyloid-β (Aβ) is the primary protein component of senile plaques in Alzheimer's disease (AD) brain, generated by sequential cleavage of the β-amyloid precursor protein (APP) by β-secretase (BACE1) and γ-secretase. The major species are Aβ(1-40) (~90%) and Aβ(1-42) (~10%, but aggregates faster and is more neurotoxic). Aβ(1-40) is a 40-mer whose N-terminal region (residues 1-28) is relatively hydrophilic and charged, while the central hydrophobic core (LVFFAED, residues 17-24) and the C-terminal highly hydrophobic region (KGA IIGLMVGGVV, residues 30-40) jointly drive self-assembly from random-coil monomers → α-helical intermediates → β-sheet oligomers → mature fibrils; soluble oligomers are considered the main neurotoxic effector in AD, causing synaptic damage, mitochondrial dysfunction, oxidative stress, and microglial activation. N-terminally 5-TAMRA (5-carboxytetramethylrhodamine)-labeled Aβ(1-40) retains full aggregation properties and neurotoxicity while providing an orange-red fluorescent tracing channel (λex≈544 nm, λem≈570 nm), widely used for: (1) FRET co-aggregation assays PAIRING with FAM-Aβ(1-40)-TAMRA serves as the FRET acceptor and FAM as the donor; mixed at defined ratios, donor quenching/acceptor sensitization reports Aβ monomer-oligomer-fibril aggregation kinetics and nucleation-elongation curves in real time; (2) ThT fluorescence co-aggregation, fluorescence polarization (FP) or autocorrelation to determine oligomerization extent and aggregation-inhibitor IC50; (3) red-fluorescence tracing of Aβ uptake, endocytosis and toxicity in cells/organoids; (4) comparing aggregation kinetics with Aβ(1-42) or mutants (E22Q Dutch, E22G Arctic, etc.); (5) in vitro screening of AD therapeutic candidates (aggregation inhibitors, anti-Aβ antibodies lecanemab/donanemab). KEY NOTES: Aβ(1-40) is extremely hydrophobic; pre-formed oligomers may exist in the powder and must be dissociated with HFIP, blown dry under nitrogen, and aliquoted at -80C; reconstitute freshly in DMSO/neutral buffer before use and avoid repeated freeze-thaw; the TAMRA label is light-sensitive-operate under reduced light throughout; Met35 is oxidation-prone and oxidized Aβ has altered aggregation behavior-strictly control oxygen. Appearance: pink-to-red powder (rhodamine pigment). | Alzheimer's disease (AD), Aβ aggregation kinetics/fibrils, FAM-TAMRA FRET co-aggregation, ThT fluorescence co-aggregation, AD drug/aggregation inhibitor screening, neurotoxicity/synaptic damage, fluorescent tracing of cellular uptake, oligomer FRET/FP analysis | Aβ(1-40) self-aggregation (monomer → oligomer → fibril); TAMRA as FRET acceptor (paired with FAM donor); TAMRA fluorescence channel λex/em≈544/570 nm; used for AD drug screening and aggregation kinetics research |
Hot Tags: 5-tamra-amyloid β-protein (1-40), China 5-tamra-amyloid β-protein (1-40) manufacturers, suppliers, factory
