Therapeutic and Pharmaceutical Peptides
Therapeutic and pharmaceutical peptides bridge the gap between small-molecule drugs and biologics — delivering the target specificity of large molecules with the scalability of chemical synthesis. SONYT supplies high-purity peptide APIs and research-grade peptides to pharmaceutical companies, distributors, contract research organizations and academic laboratories worldwide, with every batch released against HPLC and MS data.
Supply at a Glance
What Are Therapeutic Peptides?
Short amino-acid chains — typically 2 to 50 residues — engineered to act on defined biological targets, offering higher specificity and lower off-target toxicity than conventional small molecules.
Why Source from SONYT
Fmoc-based solid-phase synthesis with purification to research and pharmaceutical grade. Every shipment carries a batch-specific COA, HPLC chromatogram and MS report.
Built for Global Supply
Milligram research quantities through kilogram-scale production, cold-chain packaging and stable lead times for distributors and institutions across North America and Europe.
-
![CAS 199476-92-1 KRASG12D(8-16)]()
CAS 199476-92-1 KRASG12D(8-16)Neoantigen nonapeptide bearing KRAS G12D at residues 8-16;Category: Tumor somatic neoantigen / mutant RAS CTL epitope.Peptide Purity (HPLC) ≥95%CAS No. 199476-92-1Structure Linear 9-mer (KRAS G12D -
![FITC-εAhx-HHV-2 Env Glycoprotein G (561-578)]()
FITC-εAhx-HHV-2 Env Glycoprotein G (561-578)FITC-labeled, ε-aminocaproyl-spaced HHV-2 (HSV-2) envelope glycoprotein gG immunodominant epitope (residues 561–578), 18 residues; HPLC ≥95%.Related Documents: COA/MS/HPLC report; HSV-1/2 serotyping -
![LL-37, Human (human Cathelicidin Antimicrobial Peptide, Free Base)]()
LL-37, Human (human Cathelicidin Antimicrobial Peptide, F...•Product Name: LL-37, human (human cathelicidin LL-37, free base)•CAS No.: 154947-66-7•Sequence: [LL-37, 37 aa]•Length: 37 amino acids•Molecular Formula: -
![Daptomycin (CAS 103060-53-3)]()
Daptomycin (CAS 103060-53-3)•Product Name: Daptomycin (cyclic lipopeptide anti-MRSA/VRE antibiotic)•CAS No.: 103060-53-3•Structure: 13-residue cyclic lipopeptide N-acylated with a decanoyl fatty acid; contains non-proteinogenic -
![Nisin A (CAS 1414-45-5)]()
Nisin A (CAS 1414-45-5)•Product Name: Nisin (nisin mixture; food-grade natural preservative)•CAS No.: 1414-45-5•Structure: 34-residue lantibiotic mixture (predominantly nisin A with minor nisin Z homologues), containing 5 -
![Thanatin TFA (trifluoroacetate Salt, No CAS Number)]()
Thanatin TFA (trifluoroacetate Salt, No CAS Number)•Product Name: Thanatin TFA•CAS No.: 214542-43-5 (free base)•Sequence: GSKKPVPIIYCNRRTGKCQRM (Cys11-Cys18 disulfide)•Length: 21 amino acids•Molecular Formula (free base): C103H177N35O27S3•Molecular -
![Api137 TFA (trifluoroacetate Salt)]()
Api137 TFA (trifluoroacetate Salt)•Product Name: Api137 TFA (Stabilized Apidaecin-Derived Proline-Rich AMP)•Sequence: TMG-Orn-Asn-Asn-Arg-Pro-Val-Tyr-Ile-Pro-Arg-Pro-Arg-Pro-Pro-His-Pro-Arg-Leu•Length: 18 residues (modified Orn and -
![Clovibactin TFA (trifluoroacetate Salt)]()
Clovibactin TFA (trifluoroacetate Salt)•Product Name: Clovibactin TFA (teixobactin-derived cyclodepsipeptide antibiotic)•CAS No.: 2247194-77-8 (free base)•Structure: 8-residue depsipeptide: linear tail (residues 1-4) + macrolactone ring -
![Gramicidin (Gramicidin D Natural Mixture, CAS 1405-97-6)]()
Gramicidin (Gramicidin D Natural Mixture, CAS 1405-97-6)•Product Name: Gramicidin (gramicidin A/B/C mixture)•CAS No.: 1405-97-6•Structure: Mixture of linear 15-mers: Gramicidin A (\80%), Gramicidin B (\5-10%), Gramicidin C (~5-10%)•Representative sequence -
![LL-37, Human TFA (human Cathelicidin Antimicrobial Peptide, Trifluoroacetate Salt)]()
LL-37, Human TFA (human Cathelicidin Antimicrobial Peptid...•Product Name: LL-37, human TFA (Human Cathelicidin LL-37 TFA salt)•Sequence: [LL-37, 37 aa]•Length: 37 amino acids•Molecular Formula (free base): C205H340N60O53•Molecular -
![Polymyxin B Nonapeptide TFA (trifluoroacetate Salt, CAS 2220175-42-6)]()
Polymyxin B Nonapeptide TFA (trifluoroacetate Salt, CAS 2...•Product Name: Polymyxin B nonapeptide TFA (PMBN TFA)•CAS No.: 2220175-42-6•Structure: TFA salt of the PMBN nonapeptide ring retained after enzymatic removal of the N-terminal fatty acid and Dab1 -
![Alamethicin]()
Alamethicin•Product Name: Alamethicin (Trichoderma viride Peptaibol Ion-Channel Peptide)•CAS No.: 27061-78-5•Structure: Linear 20-mer rich in non-proteinogenic Aib (alpha-aminoisobutyric acid), N-acetylated,
Therapeutic & Pharmaceutical Peptides — FAQ
Frequently asked questions about this peptide category.
What are therapeutic and pharmaceutical peptides?
Short chains of amino acids used as active ingredients in drug development and as research tools. Compared with small-molecule drugs, peptides offer high target specificity and low toxicity, which is why this category is central to metabolic disease, oncology, and immunology research.
Which peptide classes does this category cover?
This category covers the major therapeutic peptide classes: GLP-1 receptor agonists and other metabolic peptides, RGD / integrin-binding tumor-targeting peptides, antimicrobial peptides (AMPs), cell-penetrating peptides, and peptides for immunology and vaccine research.
How are the peptides in this category quality-controlled?
Every peptide is synthesized on our Fmoc SPPS platform, and every batch must pass HPLC purity analysis and MS identity confirmation before release. Products also undergo two rounds of re-inspection before leaving the warehouse.
Can you synthesize analogs and modified sequences of these peptides?
Yes. Beyond catalog items, we synthesize custom analogs and modified sequences — including N-acetylation, C-terminal amidation, phosphorylation, and conjugation. Send us your sequence and specification and our technical team will confirm feasibility.
Can these peptides be supplied in larger volumes?
Yes. Products in this category are available from research quantities for laboratories up to larger volumes for distributors, with batch-to-batch consistency supported by our Shanghai production base.
How do I request a quotation for a peptide in this category?
Contact us with the product name, CAS number, required quantity, and destination country. Our sales team typically responds with pricing and lead time within 24 hours.
Shanghai Sonyt Biotechnology Co., Ltd. is one of the most reliable therapeutic and pharmaceutical peptides manufacturers and suppliers in China. With abundant experience, we warmly welcome you to wholesale custom made therapeutic and pharmaceutical peptides from our factory. If you have any enquiry about cooperation, please feel free to email us.
