What Are Hormone Peptides?
Peptide hormones are secreted by endocrine glands and travel through the bloodstream to target tissues, where they bind specific receptors and trigger a biological response. Typical examples include ACTH from the pituitary, somatostatin, and GLP-1 from the gut. Their effects are potent at very low concentrations, which is why both the intact hormones and their fragments are standard reagents in endocrinology laboratories.
Major Classes of Peptide Hormones
The main families include hypothalamic releasing factors that control the pituitary, pituitary hormones such as ACTH that act on downstream glands, pancreatic and gut incretins such as GLP-1 that regulate glucose metabolism, somatostatin and its analogs that modulate hormone secretion, and kinins such as bradykinin that mediate vascular and inflammatory responses.
Fragments, Analogs & Structure
Researchers frequently use truncated fragments — such as ACTH (1-14) or GLP-1 (9-36) amide — to map receptor-binding regions and study degradation pathways. Many peptide hormones carry a C-terminal amide or a disulfide-constrained ring; preserving or modifying these features is often essential to receptor affinity and stability in bioassays.
-
![CAS119719-11-8;Ilatreotide]()
CAS119719-11-8;IlatreotideCAS: 119719-11-8. Sequence: D-Phe-Cys-Tyr-D-Trp-Lys-Val-Cys-Thr-NH₂ (cyclized via Cys2-Cys7 disulfide bridge). We also provide specifications from crude to 99% purity, please contact us for details!. -
![ACTH (1-14) CAS 25696-21-3]()
ACTH (1-14) CAS 25696-21-3CAS Number: 25696-21-3. Sequence: SYSMEHFRWGKPVG. We also provide specifications from crude to 99% purity, please contact us for details!. . Related documents. COA/MS/HPLC Report. Peptide Dissolution -
![Somatostatin-25 CAS 76461-17-1]()
Somatostatin-25 CAS 76461-17-1CAS Number: 76461-17-1sequence: SNPAMAPRERKAGCKNFFWKTFTSC (Disulfide bridge: Cys14-Cys25)We also provide specifications from crude to 99% purity, please contact us for details!Related -
![GLP-1(9-36) Amide CAS 161748-29-4]()
GLP-1(9-36) Amide CAS 161748-29-4CAS: GLP-1(9-36) amide CAS 161748-29-4sequence: EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2We also provide specifications from crude to 99% purity, please contact us for details!Related documentsCOA/MS/HPLC -
![Bradykinin (1-3) CAS 23815-91-0]()
Bradykinin (1-3) CAS 23815-91-0CAS Number: 23815-91-0Sequence: RPPWe also provide specifications from crude to 99% purity, please contact us for details!Related documentsCOA/MS/HPLC ReportPeptide Dissolution and Storage Guide
FAQ
Hormone Peptides — FAQ
Frequently asked questions about this peptide category.
What are hormone peptides?
Peptides that function as hormones — short amino-acid chains released by endocrine glands to carry signals to target tissues. Well-known examples include ACTH from the pituitary, somatostatin, and GLP-1, making this class central to endocrine, metabolic, and cardiovascular research.
Which hormone peptides does this category include?
This category includes ACTH (1-14), Somatostatin-25, Ilatreotide, GLP-1 (9-36) amide, and Bradykinin (1-3) — covering pituitary hormone fragments, somatostatin analogs, incretin fragments, and kinin peptides for endocrine and cardiovascular studies.
What purity grades are available for these hormone peptides?
Hormone peptides in this category are available from crude peptide up to ≥99% purity by HPLC, according to your specification. Every batch is supplied with a Certificate of Analysis, HPLC chromatogram, and MS report.
Can you synthesize custom hormone peptide fragments and analogs?
Yes. We synthesize custom fragments and analogs of peptide hormones — including C-terminal amidation, a hallmark of many natural hormone peptides, along with N-acetylation, disulfide cyclization, and D-amino acid substitution. Send us your sequence for a feasibility review.
Can hormone peptides be supplied in larger volumes?
Yes. Products in this category are available from research quantities for laboratories up to larger volumes for distributors, with batch-to-batch consistency supported by our Shanghai production base.
How do I request a quotation for a hormone peptide?
Contact us with the product name, CAS number, required quantity, and destination country. Our sales team typically responds with pricing and lead time within 24 hours.
Shanghai Sonyt Biotechnology Co., Ltd. is one of the most reliable hormone peptide manufacturers and suppliers in China. With abundant experience, we warmly welcome you to wholesale custom made hormone peptide from our factory. If you have any enquiry about cooperation, please feel free to email us.
ACTH 1 14 , hormone peptide, Somatostatin-25
