Shanghai Sonyt Biotechnology Co., Ltd. is one of the leading manufacturers and suppliers of biotin-β-amyloid (1-40) in China, also supports custom service. Welcome to wholesale bulk high quality biotin-β-amyloid (1-40) from our factory. Contact us for more details.
| Description | Aβ1-40 accounts for ~90% of brain Aβ and readily forms fibrils. This N-biotinylated form (CAS 183906-14-1) is captured on streptavidin supports for aggregation kinetics, oligomer capture, antibody recognition and anti-aggregation drug screening. |
| Structure type | Linear 40-mer (Aβ1-40, N-biotinylated) |
| Solubility | NaOH pre-dispersion then PBS pH adjust |
| Storage | Powder, −20°C, dry, light-protected |
Product Basic Information Table
| Product Standard English Name | Product Abbreviation / Alias | Function Tags (comma-separated) | Core Structure | Molecular Formula | Exact Mass (Da) | Average MW (Da) | Salt Form | Length (aa) |
| Biotin-beta-Amyloid (1-40), human, CAS 183906-14-1 | Biotin-Abeta(1-40); Biotin-Abeta40; N-terminally biotinylated beta-amyloid peptide (1-40); biotin-labeled human Abeta40; CAS 183906-14-1 | biotinylated peptide, beta-amyloid peptide, Abeta(1-40), Alzheimer's disease, Abeta aggregation, streptavidin binding, ELISA/SPR/pull-down probe, biomarker assay | Linear 40-mer human Abeta(1-40), sequence DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV; N-terminal alpha-amine forms an amide bond with biotin; free C-terminal Val40 carboxyl; contains Met35 (oxidation-prone), 1 Tyr and 3 Phe; no Cys; amphipathic, less aggregation-prone than Abeta(1-42) but more than Abeta(1-28); net charge ~-1 at pH 7; the biotin group is stable and binds streptavidin with high affinity (Kd ~ 1e-14 M) | C204H309N55O60S2 | 4553.23 | 4556.16 | TFA/acetate exchangeable (per request); N-terminal biotin label; CAS 183906-14-1 | 40 |
Physicochemical Solubility & Storage Parameters
| Product Code | Appearance | Long-term Storage | Short-term Storage | Solution Stability | Solid Powder Stability |
| PEP-BAβ40-01 | White to off-white powder | Store at -20°C, sealed, desiccated, under argon/nitrogen, in single-use aliquots, ~2 years; AVOID REPEATED FREEZE-THAW. Abeta is amphipathic and aggregation-prone-must be aliquoted, kept near neutral pH and prepared fresh; aggregation tendency: Abeta(1-42) > Abeta(1-40). | 2-8°C for ~1-2 weeks; working aliquots at -20°C, prepare fresh. | Biotinylation improves water solubility over unmodified Abeta: pre-treat with HFIP or DMSO to monomerize, then dilute into pH 7.4 PBS to working concentration. Prepare fresh and use promptly; avoid repeated freeze-thaw, which accelerates aggregation. The biotin group is stable and forms a high-affinity noncovalent complex with streptavidin (Kd ~ 1e-14 M). | solid stable ~2 years at -20°C, sealed, desiccated, flushed with Ar/N2; Met35 may slowly oxidize to the sulfoxide on prolonged air exposure-inert gas flushing slows this. |
Functional Description
| Product Code | Frontend Short Summary | Detailed Biological Function Description | Applicable Research Areas (comma-separated) | Targets / Pathways |
| PEP-BAβ40-01 | N-terminally biotinylated human Abeta(1-40) (CAS 183906-14-1), containing the complete N-terminal hydrophilic region and the LVFFA aggregation core-used for Abeta40 aggregation/receptor-binding ELISA, SPR, streptavidin pull-down and AD biomarker research. | Beta-amyloid (Abeta) is the principal component of senile plaques (SP) in Alzheimer's disease (AD) brain, generated by sequential cleavage of the amyloid precursor protein (APP) by beta-secretase (BACE1) and gamma-secretase. Abeta(1-40) is the most abundant secretase product, and the cerebrospinal-fluid/plasma Abeta40/Abeta42 ratio is a key AD biomarker. Abeta(1-40) comprises the N-terminal charged region (residues 1-16, engaging ApoE, PrP, RAGE, mGluR5) and the central hydrophobic core LVFFA (residues 17-21, the beta-sheet nucleation motif), ending at Val40 (lacking the Ile41-Ala42 of Abeta42); it therefore aggregates and fibrillizes less than Abeta(1-42) and is more soluble-an established isoform for studying early Abeta aggregation, receptor recognition and the biology of the Abeta40/42 ratio. N-terminal biotinylation enables, via the streptavidin system: (1) ELISA/SPR/BLI measurement of Abeta40 binding to anti-Abeta antibodies, ApoE fragments, small-molecule inhibitors and receptor ectodomains; (2) streptavidin-bead/plate pull-down of Abeta interactors; (3) competitive assays of Abeta40 immunoreactivity in CSF/plasma. Note: Abeta is amphipathic and aggregation-prone-store at -20°C in aliquots under inert gas, avoid repeated freeze-thaw, keep pH neutral and prepare fresh; Met35 is oxidation-sensitive. | Alzheimer's disease (AD) mechanism, Abeta(1-40) aggregation/fibrillization, Abeta40/Abeta42 biomarker ratio, Abeta-receptor interactions (ApoE/PrP/RAGE), biotin-streptavidin pull-down, ELISA/SPR/BLI binding assays, anti-Abeta drug screening | Abeta aggregation core (LVFFA motif); ApoE, PrP(C), RAGE, mGluR5 and other Abeta receptors/chaperones; high-affinity binding to streptavidin/avidin (Kd ~ 1e-14 M) |
Hot Tags: biotin-β-amyloid (1-40), China biotin-β-amyloid (1-40) manufacturers, suppliers, factory
