Shanghai Sonyt Biotechnology Co., Ltd. is one of the leading manufacturers and suppliers of cap18 (rabbit) in China, also supports custom service. Welcome to wholesale bulk high quality cap18 (rabbit) from our factory. Contact us for more details.
| Description | CAP18 (rabbit) (CAS: 152742-15-9; 18 kDa Cationic Antimicrobial Protein) is a 37-residue cathelicidin isolated from rabbit granulocytes, sequence Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Phe-Val-Pro-Lys-Leu-Ala-Pro-Arg-Thr-Asp-Tyr-NH2. Molecular formula C202H356N64O47, MW 4433.47 Da. CAP18 shows IC50 of 20–100 nM against Gram-negative and 130–200 nM against Gram-positive bacteria. The C-terminal 37-mer is a high-affinity LPS-binding domain that neutralizes endotoxin and suppresses cytokine storm in sepsis. CAP18 is the rabbit ortholog of human LL-37 and a classic tool for studying cathelicidin anti-endotoxin and sepsis. |
| Structure type | Linear 37-mer (rabbit cathelicidin CAP18, C-amidated alpha-helical LPS-binding peptide) |
| Solubility | Readily soluble in water, dilute acetic acid |
| Storage | Powder -20C, dry, protected from light |
Product Basic Information Table
| Product Standard English Name | Product Abbreviation / Alias | Function Tags (comma-separated) | Core Structure | Molecular Formula | Exact Mass (Da) | Average MW (Da) | Salt Form | Length (aa) |
| CAP18 (rabbit) | Rabbit cathelicidin CAP18(106-142); Rabbit cationic antimicrobial protein 18 (CAS 152742-15-9) | Antimicrobial peptide, Mammalian cathelicidin, Cationic peptide, alpha-helical, Anti-Gram-negative, Endotoxin neutralization, Innate immunity | 37-residue cationic linear alpha-helical peptide, the C-terminal active fragment (106-142) of the rabbit cathelicidin precursor CAP18; sequence GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY, free C-terminus; net charge +12, strongly amphipathic, membrane-active with LPS-neutralizing ability. | C202H356N64O47 | 4430.74 | 4433.47 | TFA salt (trifluoroacetate) | 37 |
Physicochemical Solubility & Storage Parameters
| Product Code | Appearance | Long-term Storage | Short-term Storage | Solution Stability | Solid Powder Stability |
| PEP-CAP18R-01 | White powder | Store sealed and dry at -20°C; avoid repeated freeze-thaw. | Ship/place short-term at 2-8°C; aliquotted working solution ~1 month at -20°C. | Good water solubility due to high cationic charge (+12); soluble directly in water/aqueous buffer; strongly amphipathic-may aggregate/precipitate at high concentration or high salt, so prepare fresh at low concentration and low ionic strength; do not keep solution at 4°C beyond 24-48 h. | Solid powder dry-stable long-term >2 years at -20°C; stable for short-term shipping at room temperature. |
Functional Description
| Product Code | Frontend Short Summary | Detailed Biological Function Description | Applicable Research Areas (comma-separated) | Targets / Pathways |
| PEP-CAP18R-01 | C-terminal 37-aa mature active fragment of the rabbit cathelicidin precursor, a highly cationic (+12) linear alpha-helical peptide with broad-spectrum bactericidal and LPS-neutralizing activity; an innate immune effector. | CAP18(106-142) is the mature 37-residue C-terminal peptide released after proteinase-3 cleavage of rabbit cationic antimicrobial protein 18 (a cathelicidin-family precursor). As a highly cationic (net +12) amphipathic linear alpha-helical peptide, it binds negatively charged bacterial membrane components and endotoxin LPS by electrostatic attraction, inserts into the lipid bilayer to cause membrane depolarization and permeabilization, exerting potent broad-spectrum bactericidal activity-especially against Gram-negative bacteria including P. aeruginosa and drug-resistant strains. It also binds and neutralizes LPS, suppresses endotoxin-induced inflammation, and shows immunomodulatory and pro-angiogenic activities. | Antimicrobial peptide research, Anti-Gram-negative, Endotoxin/LPS neutralization, Innate immunity, Cathelicidin family, Anti-drug-resistant bacteria, Inflammation regulation | Bacterial membrane; LPS/endotoxin; TLR4 inflammatory signaling |
Hot Tags: cap18 (rabbit), China cap18 (rabbit) manufacturers, suppliers, factory, 188713-80-6, 3032621-32-9, 79404-91-4, antimicrobial peptides, CAS 143459 88 5, CAS 3032621 32 9
