Shanghai Sonyt Biotechnology Co., Ltd. is one of the leading manufacturers and suppliers of cas 115136-25-9 rvg tfa in China, also supports custom service. Welcome to wholesale bulk high quality cas 115136-25-9 rvg tfa from our factory. Contact us for more details.
| Description | RVG TFA is a 29-amino acid peptide fragment (residues 189-214) derived from the rabies virus glycoprotein (RVG), with the sequence YTIWMPENPRPGTPCDIFTNSRGKRASNG. It is provided as a trifluoroacetate (TFA) salt, and the free base has a CAS number of 115136-25-9. RVG29 is one of the most widely studied blood-brain barrier (BBB) penetrating peptides. Its mechanism of action involves specific binding to the α7 nicotinic acetylcholine receptor (α7-nAChR), which is highly expressed on brain microvascular endothelial cells. This binding triggers receptor-mediated transcytosis (RMT), enabling efficient transport of conjugated drugs, nanoparticles, siRNA, or proteins across the blood-brain barrier into the central nervous system. RVG29 contains a basic amino acid-rich region (Arg-Gly-Lys-Arg) that carries a positive charge at physiological pH, facilitating initial electrostatic interactions with negatively charged glycosaminoglycans on the cell membrane surface. Additionally, the peptide contains a cysteine residue that can be conjugated to drug carriers via disulfide bonds or maleimide chemistry. RVG TFA is widely used in brain tumor-targeted drug delivery, intracerebral delivery of therapeutics for neurodegenerative diseases (such as Alzheimer's disease and Parkinson's disease), CNS siRNA/gene therapy, brain-targeted nanomedicine development, neuroimaging probe construction, and BBB penetration mechanism research. |
| Molecular formula | C₁₄₁H₂₁₇N₄₃O₄₃S₂ |
| Molecular weight (Da) | 3266.62 |
| Structure type | Linear 29-mer peptide (TFA salt, BBB penetrating peptide / α7-nAChR targeting peptide) |
| Solubility | Readily soluble in water, PBS |
| Storage | Powder at -20°C, dry and protected from light |
Product Basic Information Table
| Product Standard English Name | Product Abbreviation / Alias | Function Tags (comma-separated) | Core Structure | Molecular Formula | Exact Mass (Da) | Average MW (Da) | Salt Form | Length (aa) |
| RVG TFA | Rabies virus glycoprotein peptide RVG TFA; neural targeting short peptide | Neural targeting peptide, blood-brain barrier penetration, CNS delivery, cell-penetrating peptide | Core targeting short peptide derived from rabies virus glycoprotein, in TFA salt form; specifically binds to nicotinic acetylcholine receptors, and mediates blood-brain barrier penetration of drugs and nucleic acids into the central nervous system | C₈₉H₁₅₅N₃₁O₂₄S·xTFA | 2060.20 (free peptide) | ~2062.1 (free peptide) | Trifluoroacetate (TFA) | 20 |
Physicochemical Solubility & Storage Parameters
| Product Code | Appearance | Long-term Storage | Short-term Storage | Solution Stability | Solid Powder Stability |
| PEP-RVG20 | White powder | Store at -20°C, sealed, dry and protected from light. Aliquot for storage. | Stable for 1 month at 2–8°C in sealed dry condition; stable for shipping at ambient temperature. | Stable for 7 days at 4°C. TFA salt is readily soluble in water, dilute acetic acid and PBS. Optimal receptor binding activity at physiological pH; peptide chain prone to degradation under strong acid/base conditions. | Stable for 2 years at -20°C, dry and protected from light. |
Functional Description
| Product Code | Frontend Short Summary (for search list display) | Detailed Biological Function Description | Applicable Research Areas (comma-separated) | Targets / Pathways |
| PEP-RVG20 | RVG short peptide TFA mediates brain delivery via acetylcholine receptor targeting | RVG peptide is a core neural targeting short peptide derived from rabies virus glycoprotein, retaining the complete acetylcholine receptor binding motif. It specifically binds nicotinic acetylcholine receptors and penetrates the blood-brain barrier via receptor-mediated endocytosis and transcytosis. | CNS drug delivery, blood-brain barrier penetration research, neurological disease therapy, brain-targeted drug development, gene therapy | Nicotinic acetylcholine receptor (nAChR); receptor-mediated endocytosis; blood-brain barrier penetration |
Hot Tags: cas 115136-25-9 rvg tfa, China cas 115136-25-9 rvg tfa manufacturers, suppliers, factory, 191936-91-1, 997-20-6, CAS 191936 91 1, CAS 651328 78 8, drug delivery peptides, HIV 1 Tat Protein Peptide 47 57
