Shanghai Sonyt Biotechnology Co., Ltd. is one of the leading manufacturers and suppliers of glp-1(9-36) amide cas 161748-29-4 in China, also supports custom service. Welcome to wholesale bulk high quality glp-1(9-36) amide cas 161748-29-4 from our factory. Contact us for more details.
| Product Name | GLP-1(9-36)Amide TFA |
| Sequence | EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Three Letter Sequence | Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
| Peptide Purity (HPLC, %) | ≥99.0% |
| Molecular Formula | C140H214N36O43.Xc2hf3o2 |
| Molecular Weight (Da) | 3089.41 |
Product Basic Information Table
| Product Standard English Name | Product Abbreviation / Alias | Function Tags (comma-separated) | Amino Acid Full Name Sequence | Molecular Formula | Exact Molecular Weight (Da) | Average Molecular Weight (Da) | Terminal Modification - N-terminus | Terminal Modification - C-terminus | Sequence Length (aa) |
| GLP-1(9-36) amide CAS 161748-29-4 |
#GLP-1(9-36)amide#;GLP1 metabolite;#GLP1 receptor antagonist#;glucose metabolism research | Endocrinology research, diabetes pharmacology, GLP receptor mechanism, DPP4 metabolism research | Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH₂ | C₁₄₀H₂₁₄N₃₆O₄₃ | 3087.57 | 3089.41 | No modification | C-terminal Amidation (-NH₂) | 28 |
Physicochemical Solubility & Storage Parameters
| Product Code | Appearance | Long-term Storage Conditions | Short-term Storage Conditions | Liquid Stability | Solid Powder Stability |
| PEP-GLP001 | White powder | -20°C, sealed, protected from light, aliquot, avoid repeated freeze-thaw | 2–8°C, use within 1 month; prepare stock solution freshly before use | Stable 24h under 4°C | Stable for 2 years at -20°C |
Functional Description
| Product Code | Frontend Short Summary (for search list display) | Detailed Biological Function Description | Applicable Research Areas (comma-separated) | Target / Receptor |
| PEP-GLP001 | GLP-1(9-36) amide is the major circulating metabolite cleaved from GLP-1(7-36)amide by DPP4, acting as GLP-1 receptor antagonist | GLP-1(9-36) amide is the primary metabolite produced by DPP4-mediated cleavage of active GLP-1(7-36) amide. It acts as a GLP-1 receptor antagonist, inhibits hepatic glucose production with weak insulinotropic effect. Widely applied for investigation of GLP-1 metabolic pathway, DPP4 pharmacology, glucose homeostasis and cardiovascular effects. | Endocrinology, diabetes pharmacology, metabolic physiology, peptide receptor modulation, DPP4 enzyme research | GLP-1 Receptor (GLP1R) |
Hot Tags: glp-1(9-36) amide cas 161748-29-4, China glp-1(9-36) amide cas 161748-29-4 manufacturers, suppliers, factory, 23815-91-0, ACTH 1 14 , CAS 161748 29 4, CAS 23815 91 0, CAS 76461 17 1, Somatostatin-25
