Shanghai Sonyt Biotechnology Co., Ltd. is one of the leading manufacturers and suppliers of β-amyloid (1-40) (tfa) in China, also supports custom service. Welcome to wholesale bulk high quality β-amyloid (1-40) (tfa) from our factory. Contact us for more details.
| Description | Human Aβ1-40, one of the most abundant physiological isoforms; TFA salt; used for aggregation, fibril structure, neurotoxicity, inhibitors and antibody epitopes. |
Product Basic Information Table
| Standard English Name | Abbreviations/Aliases | Functional Tags | Structural Core | Molecular Formula | Exact MW (Da) | Average MW (Da) | Salt Form | Length (aa) |
| β-Amyloid (1-40), human (TFA salt) | Human Aβ(1-40) TFA; Amyloid-β 1-40 (human) | Alzheimer disease,beta-amyloid,fibrillation,aggregation,neurotoxicity,microglia activation,TFA salt,AD model | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV | C194H295N53O58S1·TFA(C2HF3O2) | 4327.15 | 4329.87 | Trifluoroacetate (TFA) | 40 |
Physicochemical Solubility & Storage Parameters
| Product Code | Appearance | Long-term Storage | Short-term Storage | Solution Stability | Solid Stability |
| PEP-AB140T-01 | White to off-white powder, hygroscopic (TFA salt). | -20 °C, dry, protected from light, sealed; aliquot to avoid repeated freeze-thaw. | 2–8 °C, short-term (≤1 week); prepare fresh and use within the same day. | Aqueous solution aggregates/fibrillates readily; pretreat with HFIP to disaggregate, aliquot and lyophilize; keep on ice, use same day, avoid freeze-thaw. | powder stable ≥2 years at -20 °C dry & light-protected; use promptly after opening. |
Functional Description
| Product Code | Short Summary (listing) | Detailed Biological Function | Research Areas | Targets/Receptors |
| PEP-AB140T-01 | Standard human full-length Aβ(1-40) TFA salt; reference for AD plaque formation, fibrillation kinetics and neurotoxicity models. | Human Aβ(1-40) is one of the most abundant APP β/γ-secretase fragments; less hydrophobic and slower to aggregate than Aβ(1-42), yet the predominant isoform in CSF/plasma. It spontaneously converts from monomers/oligomers to soluble protofibrils and insoluble amyloid fibrils, and is a core tool peptide for studying Aβ aggregation kinetics, ThT fibrillation curves, oligomer toxicity, microglia/astrocyte activation, oxidative stress, mitochondrial damage and synaptic toxicity. TFA is a common lyophilization counterion; HFIP or DMSO pretreatment is recommended before use. | Alzheimer disease,amyloid plaque mechanism,aggregation kinetics,neurotoxicity,neuroinflammation,biomarker assay,drug screening | Aβ oligomers/fibrils; microglia (TLR2/4, SCARA1, CR3); RAGE; NMDA receptor; synaptic membrane |
Hot Tags: β-amyloid (1-40) (tfa), China β-amyloid (1-40) (tfa) manufacturers, suppliers, factory, Amyloid 1 11 , Amyloid 1 8 CAS 659739 33 0, Amyloid 10 20 , 152286-31-2, 190436-05-6, CAS 190436 05 6
