We develop and manufacture high-quality CAS 849352-44-9, Combi-1, 188713-80-6, attract and cultivate excellent talents, own and perfect service, establish and develop enterprise image and meet new challenges with the business philosophy of 'user's demand is our pursuit'. We adhere to the focus strategy and focuses on the categories of Cilofungin from the perspective of the future, establishing a complete sales channel and service network worldwide to provide the best products and services to global customers. The spirit of our professional conduct connotes, loyalty, diligence, efficiency and harmony. We have always follow the law of industry development and our company's own development. We are committed to fostering sustainable power of innovation and development and strengthening the construction of scientific and technological talents and skilled personnel. "The success and development of our business cannot be achieved without the support of every customer. Our company is focused on delivering value to our clients through innovation, quality, and service.
-
![Cilofungin CAS 79404-91-4]()
Cilofungin CAS 79404-91-4CAS: 79404-91-4Sequence:We also provide specifications from crude to 99% purity, please contact us for details!Related documentsCOA/MS/HPLC ReportPeptide Dissolution and Storage Guide -
![Indolicidin Acetate (bovine Neutrophil Trp-rich Cathelicidin AMP)]()
Indolicidin Acetate (bovine Neutrophil Trp-rich Cathelici...•Product Name: Indolicidin Acetate•CAS No.: 140896-21-5 (free base)•Sequence: ILPWKWPWWPWRR-NH2•Length: 13 amino acids•Molecular Formula (free base): C100H132N26O13•Molecular Weight (free base): -
![SPR741 TFA]()
SPR741 TFA•Product Name: SPR741 TFA•CAS No.: 1179330-52-9 (free base)•Structure: TFA salt of SPR741 (polymyxin B-derived cyclic-peptide outer-membrane permeabilizer)•Molecular Formula (TFA salt): -
![Aurein 2.4]()
Aurein 2.4•Product Name: Aurein 2.4•CAS No.: 302343-07-3•Sequence: Gly-Leu-Phe-Asp-Ile-Val-Lys-Lys-Val-Val-Gly-Thr-Leu-Ala-Gly-Leu-NH2•Length: 16 amino acids•Molecular Formula: C77H133N19O19•Molecular Weight: -
![CAP18 (rabbit)]()
CAP18 (rabbit)•Product Name: CAP18 (rabbit) (18 kDa Cationic Antimicrobial / LPS-Binding Protein)•CAS No.: 152742-15-9•Sequence: GLRKRLRKFRNKIKEKLKKIGQKIQGFVPKLAPRTDY-NH2•Length: 37 amino acids•Molecular Formula: -
![Heliomicin]()
Heliomicin•Product Name: Heliomicin (tobacco budworm defensin, antifungal peptide)•CAS No.: 391977-03-0•Amino Acid Sequence: -
![Cephabacin M4]()
Cephabacin M4•Product Name: Cephabacin M4 (novel cephem antibiotic)•CAS No.: 99313-74-3•Structure Type: 7-Methoxydesacetylcephalosporin, cephem antibiotic with oligopeptide side chain•Amino Acid Sequence (side -
![Sublancin]()
-
![Lariatin A]()
Lariatin AProduct Name：Lynronne-1 (rumen microbiome-derived antimicrobial peptide, anti-MRSA peptide, C-terminally amidated 19-mer)Synonyms：Lynronne-1; LPRRNRWSKIWKKVVTVFS-NH2Amino Acid
Robert Harvey
Your machinery and equipment is unmatched in this field and we hope that this transaction will maximize the benefits for both parties.
Andrew McCray
I think the price of their products is also suitable, this is a satisfied online purchase.
Blaine Hwang
Your product manager will not blindly recommend some products to us, but can recommend them to us according to our actual situation, which is really great!
David Lloyd
I have received my goods, and they are as good as the samples and the salesperson's presentation.
Samantha Wilson
Fast shipping and great service from this supplier!
James Bloomer
The customer service staff were very patient and my problem was completely resolved.
We focus on integrating the green concept into the product design of our 849352-44-9, 212370-59-7 and actively implement the sustainable development strategy. Shanghai Sonyt Biotechnology Co., Ltd. is one of the most reliable cilofungin manufacturers and suppliers in China. With abundant experience, we warmly welcome you to wholesale custom made cilofungin from our factory. If you have any enquiry about cooperation, please feel free to email us.