Shanghai Sonyt Biotechnology Co., Ltd. is one of the leading manufacturers and suppliers of cys-ll37 in China, also supports custom service. Welcome to wholesale bulk high quality cys-ll37 from our factory. Contact us for more details.
| Description | Cys-LL37 is an N-terminal cysteine-added derivative of the human cathelicidin LL-37 (MCE, no CAS registered), with the sequence CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES. Molecular formula C₂₀₈H₃₄₅N₆₁O₅₄S, molecular weight 4596.41 Da. LL-37 is the only human cathelicidin, a 37-residue amphipathic α-helical cationic peptide (net charge +6 at physiological pH) with broad-spectrum antibacterial, antifungal, antiviral, immunomodulatory and wound-healing-promoting activities. Cys-LL37 can be covalently immobilized on the surface of biomaterials such as titanium via a flexible hydrophilic polyethylene glycol spacer and selective N-terminal coupling, forming a contact-killing surface peptide layer for the development of novel antimicrobial biomaterials. Widely used in antimicrobial biomaterial development, implant surface modification and LL-37 function research. |
| Molecular formula | C₂₀₈H₃₄₅N₆₁O₅₄S |
| Molecular weight (Da) | 4596.41 |
| Structure type | Linear 38-mer (N-terminal Cys-modified, amphipathic α-helical cationic peptide) |
| Solubility | Readily soluble in water, PBS |
| Storage | Powder at -20°C, dry, protected from light |
Product Basic Information Table
| Product Standard English Name | Product Abbreviation / Alias | Function Tags (comma-separated) | Core Structure | Molecular Formula | Exact Mass (Da) | Average MW (Da) | Salt Form | Length (aa) |
| Cys-LL37 | N-terminal cysteine modified LL-37; thiolated LL-37 | LL-37 modified peptide, broad-spectrum antibacterial, immunomodulation, conjugatable modification, thiol-reactive peptide | Variant of human antimicrobial peptide LL-37 with extra cysteine residue introduced at N-terminus. Fully retains LL-37 amphipathic α-helix structure, broad-spectrum antibacterial and immunomodulatory activity. Free thiol of cysteine can be used for immobilization, fluorescent labeling or carrier conjugation | C₂₁₃H₃₆₃N₅₉O₅₃S₂ | 4507.71 | ~4510.2 | Acetate | 38 |
Physicochemical Solubility & Storage Parameters
| Product Code | Appearance | Long-term Storage | Short-term Storage | Solution Stability | Solid Powder Stability |
| PEP-CYLL37 | White powder | Store at -20°C, sealed, dry and protected from light. Aliquot. Avoid repeated freeze-thaw cycles. | Stable for 1 month at 2–8°C in sealed dry condition; stable for shipping at ambient temperature. | Stable for 7 days at 4°C. Soluble in dilute acetic acid and acidic buffers. Cysteine thiol is prone to oxidation and dimerization. Prepare fresh before use. Avoid co-incubation with oxidizing agents. | Stable for 2 years at -20°C, dry and protected from light. |
Functional Description
| Product Code | Frontend Short Summary (for search list display) | Detailed Biological Function Description | Applicable Research Areas (comma-separated) | Targets / Pathways |
| PEP-CYLL37 | N-terminal cysteine-modified LL-37 with retained activity and conjugatability | Cys-LL37 is an N-terminal cysteine variant of the human antimicrobial peptide LL-37, fully retaining the amphipathic α-helix, broad-spectrum antibacterial and immunomodulatory activities of the parent peptide. The additional N-terminal free thiol enables fluorescent labeling, biotinylation, solid-phase immobilization and nanoparticle conjugation via thiol-maleimide chemistry, expanding the applications of LL-37 in biomaterials, biosensing and targeted delivery. | LL-37 modification & application, AMP immobilization, biomaterial modification, targeted delivery systems, thiol conjugation chemistry | Bacterial membrane lysis; immunomodulatory pathways; site-specific thiol conjugation |
Hot Tags: cys-ll37, China cys-ll37 manufacturers, suppliers, factory, 143459-88-5, 79404-91-4, 849352-44-9, CAS 849352 44 9, Cilofungin, CP7-FP13-2
