-
![Polymyxin B Nonapeptide (PMBN, Free Base, CAS 86408-36-8)]()
Polymyxin B Nonapeptide (PMBN, Free Base, CAS 86408-36-8)•Product Name: Polymyxin B nonapeptide (PMBN, delipidated outer-membrane permeabilizer)•CAS No.: 86408-36-8•Structure: Nonapeptide ring retained after enzymatic removal of the N-terminal fatty acid -
![Iturin A (cyclic Lipopeptide Antifungal Antibiotic From Bacillus Subtilis)]()
Iturin A (cyclic Lipopeptide Antifungal Antibiotic From B...•Product Name: Iturin A (Bacillus subtilis Cyclic Lipopeptide Antifungal Antibiotic)•CAS No.: 52229-90-0•Structure: Cyclic heptapeptide (2 D-Tyr, 3 Asn, Gln, Pro, Ser) linked via amide bond to a -
![LL-37, Human Acetate (human Cathelicidin Antimicrobial Peptide, C-amidated, Acetate Salt)]()
LL-37, Human Acetate (human Cathelicidin Antimicrobial Pe...•Product Name: LL-37, human acetate (Human Cathelicidin LL-37 Acetate)•Sequence: [LL-37, 37 aa]•Length: 37 amino acids•Molecular Formula (free base): C205H340N60O53•Molecular -
![SPR741 Acetate]()
SPR741 Acetate•Product Name: SPR741 acetate (NAB741 acetate; polymyxin-B-derived outer-membrane permeabilizer)•CAS No.: 1179330-52-9 (free base)•Molecular Formula (free base): C44H73N13O13•Molecular Weight (free -
![Magainin 2]()
Magainin 2•Product Name: Magainin 2•CAS No.: 108433-95-0•Sequence: GIGKFLHSAKKFGKAFVGEIMNS•Length: 23 amino acids•Molecular Formula: C114H180N30O29S•Molecular Weight: 2466.9 Da•Origin: Skin secretions of the -
![Melittin TFA]()
Melittin TFA•Product Name: Melittin TFA (Bee Venom Melittin, TFA salt)•CAS No.: 20449-79-0 (free base)•Sequence: GIGAVLKVLTTGLPALISWIKRKRQQ-NH2•Length: 26 amino acids•Molecular Formula (free base): -
![Cecropin B (Bombyx Mori / Lepidopteran Cecropin)]()
Cecropin B (Bombyx Mori / Lepidopteran Cecropin)•Product Name: Cecropin B (C-amidated)•CAS No.: 80451-05-4•Sequence: KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2•Length: 35 amino acids•Molecular Formula: C176H302N52O41S•Molecular Weight: 3834.67 -
![Maculosin (cyclo(L-Pro-L-Tyr), A Diketopiperazine Phytotoxin)]()
Maculosin (cyclo(L-Pro-L-Tyr), A Diketopiperazine Phytoto...•Product Name: Maculosin (cyclo(L-Pro-L-Tyr), host-specific fungal phytotoxin DKP)•CAS No.: 4549-02-4•Structure: 2,5-Diketopiperazine from head-to-tail cyclization of L-proline and L-tyrosine, -
![Cecropin A (free Base, TFA-free)]()
Cecropin A (free Base, TFA-free)•Product Name: Cecropin A (C-amidated)•CAS No.: 80451-04-3•Sequence: KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2•Length: 37 amino acids•Molecular Formula: C184H313N53O46•Molecular Weight: 4003.8 -
![Polymyxin B1 (polymyxin B Cyclic Lipopeptide Antibiotic, CAS 4135-11-9)]()
Polymyxin B1 (polymyxin B Cyclic Lipopeptide Antibiotic, ...•Product Name: Polymyxin B1•CAS No.: 4135-11-9•Structure: N-terminal (S)-6-methyloctanoyl fatty acid + linear tripeptide tail + heptapeptide ring (6 diaminobutyric acids, D-Phe at position -
![Lactoferrin (17-41) Acetate (bovine Lactoferrin Residues 17-41 / Lactoferricin B Acetate, CAS 282843-30-1)]()
Lactoferrin (17-41) Acetate (bovine Lactoferrin Residues ...•Product Name: Lactoferrin (17-41) acetate (Lactoferricin B acetate; Lfcin B)•CAS No.: 2828433-30-1•Sequence: FKCRRWQWRMKKLGAPSITCVRRAF (Cys3-Cys20 disulfide)•Length: 25 amino acids•Molecular Formula -
![Cyclo(L-Trp-L-Trp) (cyclo(tryptophyl-tryptophan) Cyclic Dipeptide, CAS 20829-55-4)]()
Cyclo(L-Trp-L-Trp) (cyclo(tryptophyl-tryptophan) Cyclic D...•Product Name: Cyclo(L-Trp-L-Trp) (cyclo(-Trp-Trp), ditryptophan diketopiperazine)•CAS No.: 20829-55-4•Structure: Two L-tryptophans head-to-tail cyclized 2,5-diketopiperazine•Molecular Formula:
Shanghai Sonyt Biotechnology Co., Ltd. is one of the most reliable therapeutic and pharmaceutical peptides manufacturers and suppliers in China. With abundant experience, we warmly welcome you to wholesale custom made therapeutic and pharmaceutical peptides from our factory. If you have any enquiry about cooperation, please feel free to email us.
