Shanghai Sonyt Biotechnology Co., Ltd. is one of the leading manufacturers and suppliers of crotalicidin in China, also supports custom service. Welcome to wholesale bulk high quality crotalicidin from our factory. Contact us for more details.
| Description | Crotalicidin (CAS: 1818372-26-7, Ctn) is a 34-residue cathelicidin isolated from the venom of the South American rattlesnake Crotalus durissus terrificus, sequence KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF. Molecular formula C₂₀₃H₃₄₆N₅₄O₃₆S, MW 4151.39 Da. Its N-terminus adopts an alpha-helical conformation while the C-terminus is random coil. Crotalicidin exhibits activity against both Gram-positive and Gram-negative bacteria, as well as antifungal and antitumor activity. As a member of the snake venom cathelicidin family (homologous to batroxicidin and Pt_CRAMP1), crotalicidin and its truncated analog Ctn[15-34] are tools for studying snake venom host defense peptides, membrane-active mechanisms, and anticancer leads. |
| Structure type | Linear 34-mer (snake venom cathelicidin, N-terminal alpha-helix + C-terminal random coil) |
| Solubility | Readily soluble in water, dilute acetic acid |
| Storage | Powder -20°C, dry, protected from light |
Product Basic Information Table
| Product Standard English Name | Product Abbreviation / Alias | Function Tags (comma-separated) | Core Structure | Molecular Formula | Exact Mass (Da) | Average MW (Da) | Salt Form | Length (aa) |
| Crotalicidin | Rattlesnake AMP; South American rattlesnake cathelicidin | Antimicrobial peptide, broad-spectrum antibacterial, antifungal, anti-endotoxin, venom-derived peptide | Cathelicidin family-derived peptide from South American rattlesnake venom, with cationic amphipathic α-helix structure; positively charged face mediates membrane binding and penetration | C₁₅₃H₂₆₅N₄₇O₃₃S | 3293.02 | ~3295.2 | Acetate | 29 |
Physicochemical Solubility & Storage Parameters
| Product Code | Appearance | Long-term Storage | Short-term Storage | Solution Stability | Solid Powder Stability |
| PEP-CRO29 | White powder | Store at -20°C, sealed, dry and protected from light. Aliquot. Avoid repeated freeze-thaw cycles. | Stable for 1 month at 2–8°C in sealed dry condition; stable for shipping at ambient temperature. | Stable for 7 days at 4°C. Soluble in dilute acetic acid and acidic buffers. Long α-helix is sensitive to temperature and freeze-thaw; repeated cycles cause helix unfolding and activity loss. | Stable for 2 years at -20°C, dry and protected from light. |
Functional Description
| Product Code | Frontend Short Summary (for search list display) | Detailed Biological Function Description | Applicable Research Areas (comma-separated) | Targets / Pathways |
| PEP-CRO29 | Crotalicidin rattlesnake peptide with broad antibacterial and endotoxin-neutralizing effects | Crotalicidin is an active cathelicidin-derived peptide from South American rattlesnake venom, adopting a typical cationic amphipathic α-helical structure. It rapidly penetrates bacterial cell membranes, exerting broad-spectrum bactericidal activity against Gram-positive, Gram-negative bacteria and fungi. It also effectively binds and neutralizes endotoxin LPS, inhibits endotoxin-induced inflammation, and exhibits moderate antitumor activity, serving as a model for studying the structure-activity relationship of venom-derived AMPs. | Venom-derived AMPs, broad-spectrum anti-infection, endotoxin research, cathelicidin family, structure-activity relationship | Bacterial membrane penetration; endotoxin LPS neutralization; inflammatory pathway inhibition |
Hot Tags: crotalicidin, China crotalicidin manufacturers, suppliers, factory, 143459-88-5, 79404-91-4, antimicrobial peptides, CAS 79404 91 4, Cilofungin, Elf18
