Shanghai Sonyt Biotechnology Co., Ltd. is one of the leading manufacturers and suppliers of cagrilintide cas 1415456-99-3 in China, also supports custom service. Welcome to wholesale bulk high quality cagrilintide cas 1415456-99-3 from our factory. Contact us for more details.
| Product name | CAS:1415456-99-3;Cagrilintide |
| Sequence | {Eicosanedioic acid-Y-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:Cys3-Cys8) |
| Three letter sequence | {Eicosanedioic acid-Y-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2 (Disulfide bridge:Cys3-Cys8) |
| Peptide purity (HPLC, %) | 95%/99% |
| Molecular formula | C194H312N54O59S2 |
| Molecular weight (Da) | 4409.01 |
Product Basic Information Table
| Product Standard English Name | Product Abbreviation / Alias | Function Tags (comma-separated) | Amino Acid Full Name Sequence | Molecular Formula | Exact Molecular Weight (Da) | Average Molecular Weight (Da) | Terminal Modification - N-terminus | Terminal Modification - C-terminus | Sequence Length (aa) |
| Cagrilintide | #Cagrilintide; CAS 1415456-99-3; AM833; Long-acting acylated amylin analog; Weight-loss peptide | Amylin receptor agonist, Long-acting anti-obesity peptide, Appetite suppression, Glycemic regulation, Obesity metabolism research, CTR/AMY receptor, Albumin-binding lipid modification, Metabolic endocrine peptide | Eicosanedioic acid-γ-Glu-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Leu-Gln-Thr-Tyr-Arg-Asn-Asn-Phe-Val-His-Leu-Ser-Cys-Thr-Cys-Ser-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr | C₁₉₄H₃₁₂N₅₄O₅₉S₂ | 4406.25 | 4409.01 | N-terminal eicosanedioic acid lipid acylation (long fatty acid chain) | Free carboxyl, unmodified | 37 |
Physicochemical Solubility & Storage Parameters
| Product Code | Appearance | Long-term Storage Conditions | Short-term Storage Conditions | Liquid Stability | Solid Powder Stability |
| PEP-CAG001 | White powder | -20°C, sealed and light-proof, aliquot to avoid repeated freeze-thaw | 2~8°C, use within 1 month, prepare fresh and sterile-filter before use | Stable for 36 h at 4°C | Stable for 3 years at -20°C |
Functional Description
| Product Code | Frontend Short Summary (for search list display) | Detailed Biological Function Description | Applicable Research Areas (comma-separated) | Target / Receptor |
| PEP-CAG001 | Cagrilintide is a long-acting lipidated amylin analog, potent agonist of amylin AMY receptors and calcitonin CTR receptor, suppresses food intake, induces weight loss and stabilizes postprandial blood glucose, core tool peptide for obesity & metabolic syndrome research | Cagrilintide (AM833) is a synthetic stabilized amylin analog modified with long-chain eicosanedioic acid. Double intramolecular disulfide bonds maintain cyclic conformation; N-terminal fatty acid chain enables high-affinity serum albumin binding, drastically extending in-vivo half-life. It non-selectively potently activates all amylin receptor subtypes AMY1/AMY2/AMY3 and calcitonin receptor CTR. It suppresses hunger signaling via central nervous system, delays gastric emptying, reduces calorie intake, inhibits glucagon secretion and smooths postprandial glucose excursion. In preclinical models, it drives significant weight loss, alleviates insulin resistance and regulates lipid metabolism. Widely applied in obesity, type 2 diabetes, metabolic syndrome, neural regulation of feeding behavior, GPCR peptide pharmacology and long-acting peptide delivery mechanism studies | Metabolic endocrinology, Obesity weight-loss research, Type 2 diabetes models, Feeding behavior regulation, Calcitonin receptor pharmacology, Long-acting peptide formulation, Insulin resistance mechanism, Metabolic syndrome drug screening | Amylin receptors AMY1R, AMY2R, AMY3R; Calcitonin receptor CTR (GPCR family) |
Hot Tags: cagrilintide cas 1415456-99-3, China cagrilintide cas 1415456-99-3 manufacturers, suppliers, factory, 1415456-99-3, 1566590-77-9, BPC 157, CAS 129954 34 3, CAS 1415456 99 3, Melanotan II
