Shanghai Sonyt Biotechnology Co., Ltd. is one of the leading manufacturers and suppliers of glun1(359-378) in China, also supports custom service. Welcome to wholesale bulk high quality glun1(359-378) from our factory. Contact us for more details.
| Description | The core 20-mer within GluN1 356–385; used for fine epitope mapping of anti-NMDAR encephalitis autoantibodies. |
Product Basic Information Table
| Product Standard English Name | Product Abbreviation / Alias | Function Tags (comma-separated) | Core Structure | Molecular Formula | Exact Mass (Da) | Average MW (Da) | Salt Form | Length (aa) |
| GluN1 (359-378) | human NMDAR GluN1 (GRIN1/Q05586) residues 359-378 20-mer, sub-region of 356-385, anti-NMDAR encephalitis epitope | NMDAR, GluN1/GRIN1, anti-NMDAR encephalitis, autoantigen epitope, fine epitope mapping, N-terminal domain (NTD) | H-Arg-Lys-Leu-Val-Gln-Val-Gly-Ile-Tyr-Asn-Gly-Thr-His-Val-Ile-Pro-Asn-Asp-Arg-Lys-OH (RKLVQVGIYNGTHVIPNDRK, linear 20-mer, residues 359-378 of UniProt Q05586 isoform 1 full-length numbering; central sub-region of the 30-mer 356-385; contains 1 Tyr, 1 Arg, 2 Lys, 1 His; no Cys/Met/Trp) | C102H171N33O28 | 2306.30 | 2307.68 | TFA salt (typical) | 20 |
Physicochemical Solubility & Storage Parameters
| Product Code | Appearance | Long-term Storage | Short-term Storage | Solution Stability | Solid Powder Stability |
| PEP-GLUN1B-01 | White to off-white powder | Store frozen below -20°C, dry, sealed and protected from light; avoid repeated freeze-thaw; contains 1 Tyr (light-sensitive) - protect from light; powder stable for 2-3 years at -20°C | Store sealed, dry and protected from light at 4°C, use within 2-4 weeks; after reconstitution aliquot into single-use portions and store at -20°C, avoid repeated freeze-thaw | Relatively hydrophilic (1 Arg, 2 Lys positive; 1 Asp negative; polar Gly/Thr/Asn); soluble in sterile water or PBS (pH 7.4), dilute acetic acid if needed; contains 1 Tyr (light-sensitive) - protect from light; after reconstitution aliquot into single-use portions and avoid repeated freeze-thaw | powder stable for 2-3 years at -20°C when dry, protected from light and sealed; TFA salt is hygroscopic - protect from moisture, aliquot promptly after opening and keep in a desiccator |
Functional Description
| Product Code | Frontend Short Summary | Detailed Biological Function Description | Applicable Research Areas (comma-separated) | Targets / Pathways |
| PEP-GLUN1B-01 | 20-mer corresponding to residues 359-378 of human NMDAR GluN1 (GRIN1, Q05586) (RKLVQVGIYNGTHVIPNDRK), the central sub-region of the 356-385 30-mer, used for fine epitope mapping in anti-NMDAR encephalitis. | This peptide corresponds to residues 359-378 of the human NMDAR GluN1 subunit (GRIN1, UniProt Q05586 isoform 1, 938 aa full length), sequence RKLVQVGIYNGTHVIPNDRK, numbered on the same UniProt full-length system; it is the central sub-region (positions 4-23) of the GluN1 (356-385) 30-mer (LQNRKLVQVGIYNGTHVIPNDRKIIWPGGE), and the two products share one numbering system with consistent overlap. This 20-mer also lies in the extracellular N-terminal domain of GluN1 and is used for fine mapping and truncation analysis of anti-NMDAR encephalitis autoantibody epitopes to define the shortest core recognition motif. Sequence confirmed by MCE catalog (MCE: Arg-Lys-Leu-Val-Gln-Val-Gly-Ile-Tyr-Asn-Gly-Thr-His-Val-Ile-Pro-Asn-Asp-Arg-Lys). No Cys/Met/Trp; contains 1 Tyr - protect from light. | anti-NMDAR encephalitis, autoimmune encephalitis, fine epitope mapping, autoantibody detection, NMDAR structure-function, neuroimmunology | NMDAR GluN1 subunit (GRIN1/Q05586) N-terminal domain; anti-GluN1 autoantibodies |
Hot Tags: glun1(359-378), China glun1(359-378) manufacturers, suppliers, factory
