Shanghai Sonyt Biotechnology Co., Ltd. is one of the leading manufacturers and suppliers of glun1(356-385) in China, also supports custom service. Welcome to wholesale bulk high quality glun1(356-385) from our factory. Contact us for more details.
↵
| Description | The GluN1/NR1 extracellular-loop residues 356–385, involved in receptor conformation/regulation; used for NMDAR structure-function and anti-NMDAR encephalitis antibodies. |
Product Basic Information Table
| Product Standard English Name | Product Abbreviation / Alias | Function Tags (comma-separated) | Core Structure | Molecular Formula | Exact Mass (Da) | Average MW (Da) | Salt Form | Length (aa) |
| GluN1 (356-385) | human NMDAR GluN1 (GRIN1/Q05586) residues 356-385 30-mer, anti-NMDAR encephalitis antigen peptide, NTD epitope | NMDAR, GluN1/GRIN1, anti-NMDAR encephalitis, autoimmune encephalitis, autoantigen epitope, N-terminal domain (NTD), long peptide | H-Leu-Gln-Asn-Arg-Lys-Leu-Val-Gln-Val-Gly-Ile-Tyr-Asn-Gly-Thr-His-Val-Ile-Pro-Asn-Asp-Arg-Lys-Ile-Ile-Trp-Pro-Gly-Gly-Glu-OH (LQNRKLVQVGIYNGTHVIPNDRKIIWPGGE, linear 30-mer, residues 356-385 of UniProt Q05586 isoform 1 full-length numbering; contains 1 Trp, 1 Tyr, 2 Arg, 2 Lys, 1 His; no Cys/Met) | C154H248N46O42 | 3413.87 | 3415.95 | TFA salt (typical) | 30 |
Physicochemical Solubility & Storage Parameters
| Product Code | Appearance | Long-term Storage | Short-term Storage | Solution Stability | Solid Powder Stability |
| PEP-GLUN1-01 | White to off-white powder | Store frozen below -20°C, dry, sealed and protected from light; avoid repeated freeze-thaw; long peptide (30 aa) must be aliquoted into single-use portions to prevent aggregation; contains 1 Trp and 1 Tyr (light-sensitive) - protect from light; powder stable for 2-3 years at -20°C | Store sealed, dry and protected from light at 4°C, use within 2-4 weeks; after reconstitution aliquot into single-use portions and store at -20°C, avoid repeated freeze-thaw | Moderately hydrophilic and amphipathic (2 Arg, 2 Lys positive; 1 Asp/1 Glu negative; hydrophobic Trp/Leu/Ile); first wet with a small amount of sterile water or dilute acetic acid, then dilute with PBS (pH 7.4) to working concentration; as a 30-mer it has an aggregation tendency - prepare fresh, aliquot into single-use portions and avoid repeated freeze-thaw; Trp/Tyr are light-sensitive - protect from light | powder stable for 2-3 years at -20°C when dry, protected from light and sealed; TFA salt is hygroscopic - protect from moisture, aliquot promptly after opening and keep in a desiccator |
Functional Description
| Product Code | Frontend Short Summary | Detailed Biological Function Description | Applicable Research Areas (comma-separated) | Targets / Pathways |
| PEP-GLUN1-01 | 30-mer corresponding to residues 356-385 of human NMDAR GluN1 (GRIN1, UniProt Q05586) (LQNRKLVQVGIYNGTHVIPNDRKIIWPGGE), located in the N-terminal domain, used as an autoantigen epitope for anti-NMDAR encephalitis research. | This peptide corresponds to residues 356-385 of the human N-methyl-D-aspartate receptor (NMDAR) GluN1 subunit (GRIN1, UniProt Q05586 isoform 1, 938 aa full length), sequence LQNRKLVQVGIYNGTHVIPNDRKIIWPGGE, numbered according to the UniProt full-length sequence. This region lies in the extracellular N-terminal domain (ATD/NTD) of GluN1 and is one of the key antigenic regions recognized by autoantibodies in anti-NMDAR encephalitis; the synthetic peptide is used to induce experimental autoimmune encephalitis models by active immunization, for anti-GluN1 antibody detection/epitope mapping, and for studies of NMDAR autoimmunity. Sequence cross-confirmed by MCE and Shanghai Maokang supplier catalogs (MCE: Leu-Gln-Asn-Arg-Lys-Leu-Val-Gln-Val-Gly-Ile-Tyr-Asn-Gly-Thr-His-Val-Ile-Pro-Asn-Asp-Arg-Lys-Ile-Ile-Trp-Pro-Gly-Gly-Glu). No Cys/Met; contains 1 Trp and 1 Tyr - protect from light. | anti-NMDAR encephalitis, autoimmune encephalitis, neuropsychiatry, autoantigen epitope mapping, experimental autoimmune models, NMDAR structure-function | NMDAR GluN1 subunit (GRIN1/Q05586) N-terminal domain; anti-GluN1 autoantibodies |
Hot Tags: glun1(356-385), China glun1(356-385) manufacturers, suppliers, factory
