Shanghai Sonyt Biotechnology Co., Ltd. is one of the leading manufacturers and suppliers of ryr1(3614-3643) in China, also supports custom service. Welcome to wholesale bulk high quality ryr1(3614-3643) from our factory. Contact us for more details.
↵
| Description | Sarcoplasmic-reticulum calcium-release channel RyR1 residues 3614–3643; RyR1 autoantibodies are linked to myasthenia/malignant-hyperthermia/cardiomyopathy; used for autoantibody and myopathy studies. |
Product Basic Information Table
| Product Standard English Name | Product Abbreviation / Alias | Function Tags (comma-separated) | Core Structure | Molecular Formula | Exact Mass (Da) | Average MW (Da) | Salt Form | Length (aa) |
| RyR1 (3614-3643) (Ryanodine Receptor 1 Calmodulin-Binding Peptide, CaMBP; no CAS) | RyR1 CaMBP, RyR1 (3614-3643), KSKKAVWHKLLSKQRRRAVVACFRMTPLYN, Calmodulin-binding peptide, H-Lys-Ser-Lys-Lys-Ala-Val-Trp-His-Lys-Leu-Leu-Ser-Lys-Gln-Arg-Arg-Arg-Ala-Val-Val-Ala-Cys-Phe-Arg-Met-Thr-Pro-Leu-Tyr-Asn-OH, PEP-RYR1-01 | Ryanodine receptor (RyR1), calmodulin (CaM)-binding peptide, calcium signaling, skeletal-muscle excitation-contraction coupling, apo-CaM/Ca2+-CaM binding, highly cationic peptide, Cys/Met oxidation protection, Trp/Tyr light protection | H-Lys-Ser-Lys-Lys-Ala-Val-Trp-His-Lys-Leu-Leu-Ser-Lys-Gln-Arg-Arg-Arg-Ala-Val-Val-Ala-Cys-Phe-Arg-Met-Thr-Pro-Leu-Tyr-Asn-OH (KSKKAVWHKLLSKQRRRAVVACFRMTPLYN, linear 30-mer, free N-terminal amino / free C-terminal carboxyl); the calmodulin-binding region (CaMBP) of RyR1 residues 3614-3643; contains Trp x1, Tyr x1, His x1, Cys x1, Met x1; net charge ~+10 | C163H272N52O37S2 | 3614.04 | 3616.42 | Not specified (per COA) | 30 |
Physicochemical Solubility & Storage Parameters
| Product Code | Appearance | Long-term Storage | Short-term Storage | Solution Stability | Solid Powder Stability |
| PEP-RYR1-01 | white to off-white to pale yellow | Store frozen below -20°C, dry, sealed and light-protected; contains Cys x1 and Met x1 which are oxidation-prone-avoid oxidants, preferably deoxygenate/store under inert (Ar/N2) atmosphere, and strictly avoid repeated freeze-thaw; Trp/Tyr require light protection | Store at 4°C sealed, dry, light-protected and away from oxidants, use within 1-2 weeks; after reconstitution, aliquot immediately and store light-protected at -20°C or below under deoxygenated/inert atmosphere; avoid repeated freeze-thaw | Net charge ~+10 (a cluster of Lys/Arg), a highly cationic peptide with good aqueous solubility-reconstitute directly in sterile water or pH 7.4 PBS; however, Cys x1 and Met x1 are readily oxidized, so use deoxygenated buffer, avoid oxidants and air, preferably handle under inert atmosphere and use promptly; Trp x1 and Tyr x1 are light-sensitive-keep protected from light; store aliquots light-protected at -20°C and avoid repeated freeze-thaw to prevent Cys oxidation/dimerization and Met sulfoxidation | Store powder at -20°C, dry, light-protected and sealed; protect from moisture and light; weigh promptly after opening and reseal with desiccant/inert gas to avoid moisture uptake and oxidation; because of Cys/Met, long-term storage is best in an Ar/N2-flushed desiccator |
Functional Description
| Product Code | Frontend Short Summary | Detailed Biological Function Description | Applicable Research Areas (comma-separated) | Targets / Pathways |
| PEP-RYR1-01 | The 30-mer RyR1 calmodulin-binding peptide (CaMBP, KSKKAVWHKLLSKQRRRAVVACFRMTPLYN, residues 3614-3643 of the Ryanodine Receptor 1), which binds both apo-CaM and Ca2+-CaM; used in calcium signaling, skeletal-muscle excitation-contraction coupling and calmodulin-interaction studies. | The Ryanodine Receptor 1 (RyR1) is a large Ca2+-release channel in the skeletal-muscle sarcoplasmic reticulum that mediates Ca2+ release from the SR into the cytoplasm during excitation-contraction coupling; its activity is regulated by accessory proteins including calmodulin (CaM)-apo-CaM (Ca2+-free) generally activates RyR1, whereas Ca2+-CaM inhibits channel opening. This peptide corresponds to RyR1 residues 3614-3643, KSKKAVWHKLLSKQRRRAVVACFRMTPLYN, the classical RyR1 calmodulin-binding peptide (CaMBP; confirmed against UniProt P21817; the sequence is identical across human, mouse, rat and rabbit). Deletion-mutagenesis work (J Biol Chem 2001, 276:2069) established this region as the critical segment through which RyR1 binds both apo-CaM and Ca2+-CaM. It can be used as a CaM-binding reference peptide in studies of calmodulin-target interaction, calcium signaling, skeletal-muscle excitation-contraction coupling, and RyR1 channel regulation. Note: the sequence contains 1 Cys and 1 Met, which are prone to oxidation (Cys disulfide/dimerization, Met sulfoxide formation)-avoid oxidants, deoxygenate/use inert atmosphere and avoid repeated freeze-thaw; it also contains 1 Trp and 1 Tyr, so keep light-protected. | Calcium signaling, skeletal-muscle excitation-contraction coupling, Ryanodine receptor (RyR1), calmodulin (CaM) interaction, sarcoplasmic-reticulum Ca2+-release channel | RyR1 calmodulin-binding region (CaMBP); calmodulin (apo-CaM / Ca2+-CaM) |
Hot Tags: ryr1(3614-3643), China ryr1(3614-3643) manufacturers, suppliers, factory, 124454-83-7, 199727-68-9, 2293841-58-2, BCMA72-80, CAS 125366 42 9, epitope peptides
