Shanghai Sonyt Biotechnology Co., Ltd. is one of the leading manufacturers and suppliers of tat-ha-nr2b9c in China, also supports custom service. Welcome to wholesale bulk high quality tat-ha-nr2b9c from our factory. Contact us for more details.
| Description | A Tat–HA–NR2B9c fusion uncoupling NMDAR–PSD-95–nNOS signaling without blocking ion flux; a tool related to the stroke neuroprotectant NA-1/nerinetide. |
Product Basic Information Table
| Product Standard English Name | Product Abbreviation / Alias | Function Tags (comma-separated) | Core Structure | Molecular Formula | Exact Mass (Da) | Average MW (Da) | Salt Form | Length (aa) |
| Tat-HA-NR2B9c | Tat-HA-NR2B9, recombinant PSD-95 uncoupling peptide, Tat-PTD + HA tag + NR2B9c, neuroprotective peptide for ischemic stroke | neuroprotective peptide, PSD-95-NMDAR uncoupling, cell-penetrating Tat, HA tag, ischemic stroke, global cerebral ischemia, neuropathic pain | H-Pro-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Gly-Lys-Leu-Ser-Ser-Ile-Glu-Ser-Asp-Val-OH (PGYGRKKRRQRRRGYPYDVPDYAGKLSSIESDV, linear 33-mer chimeric peptide; N-terminal Pro-Gly residual from recombinant expression; Tat 47-57 (YGRKKRRQRRR) joined via a Gly spacer to the influenza hemagglutinin HA epitope tag (YPYDVPDYA) and then to the GluN2B C-terminal 9-mer NR2B9c (KLSSIESDV); contains 4 Tyr, 6 Arg, 3 Lys; no Cys/Met/Trp) | C169H269N55O50 | 3869.02 | 3871.33 | TFA salt (typical) | 33 |
Physicochemical Solubility & Storage Parameters
| Product Code | Appearance | Long-term Storage | Short-term Storage | Solution Stability | Solid Powder Stability |
| PEP-THNR2B-01 | White to off-white powder | Store frozen below -20°C, dry, sealed and protected from light; avoid repeated freeze-thaw; long peptide (33 aa) must be aliquoted into single-use portions; contains 4 Tyr (light-sensitive) - protect from light; TFA salt - protect from moisture; powder stable for 2-3 years at -20°C | Store sealed, dry and protected from light at 4°C, use within 2-4 weeks; after reconstitution aliquot into single-use portions and store at -20°C, avoid repeated freeze-thaw | Strongly cationic (6 Arg, 3 Lys, net charge ~+5) with excellent water solubility; soluble directly in sterile water or PBS (pH 7.4); the HA tag (2 Asp) and NR2B9c (Asp/Glu) add some negative charge but the peptide remains water-soluble; as a long peptide it tends to aggregate - prepare fresh and aliquot into single-use portions; 4 Tyr residues are light-sensitive - protect from light during handling and storage | powder stable for 2-3 years at -20°C when dry, protected from light and sealed; TFA salt is hygroscopic - protect from moisture, aliquot promptly after opening and keep in a desiccator |
Functional Description
| Product Code | Frontend Short Summary | Detailed Biological Function Description | Applicable Research Areas (comma-separated) | Targets / Pathways |
| PEP-THNR2B-01 | Recombinant neuroprotective chimeric peptide Tat-HA-NR2B9c (33 aa), composed of the Tat transduction domain + HA tag + GluN2B C-terminal 9-mer, uncoupling PSD-95-NMDAR for neuroprotection in ischemic stroke and global cerebral ischemia. | Tat-HA-NR2B9c is a chimeric peptide recombinantly built on the classic neuroprotective agent nerinetide (NA-1/Tat-NR2B9c = YGRKKRRQRRRKLSSIESDV): N-terminal HIV-1 Tat protein transduction domain (residues 47-57, YGRKKRRQRRR), an inserted influenza hemagglutinin (HA) epitope tag (YPYDVPDYA) for antibody detection, and the C-terminal 9-mer NR2B9c (KLSSIESDV) of GluN2B (NR2B), with Gly spacers and an N-terminal Pro-Gly residual from recombinant expression (Zhou et al., Protein Expr Purif 2012, PMID 22944204). NR2B9c mimics the tSXV PDZ-ligand motif at the GluN2B C-terminus and binds the PSD-95 (DLG4) PDZ2 domain with high affinity, disrupting the NMDAR-PSD-95-nNOS toxic-signaling complex and reducing post-ischemic excitotoxic nitric oxide production. In rat middle cerebral artery occlusion (MCAO)/reperfusion models it reduces infarct volume and improves neurological function; later work shows benefits for regenerative repair after focal/global ischemia and for oxaliplatin-induced neuropathic pain. Formula C169H269N55O50, average MW ~3871.33 Da (consistent with PeptideDb catalog data). | ischemic stroke, global cerebral ischemia, neuroprotection, PSD-95-NMDAR coupling, cell-penetrating peptide, neuropathic pain, HA-tag tracing | PSD-95 (DLG4) PDZ2 domain; GluN2B/NMDAR intracellular C-terminus; nNOS-PSD-95-NMDAR complex |
Hot Tags: tat-ha-nr2b9c, China tat-ha-nr2b9c manufacturers, suppliers, factory
